Structure of PDB 4v67 Chain DZ

Receptor sequence
>4v67DZ (length=187) Species: 274 (Thermus thermophilus) [Search protein sequence]
YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAA
3D structure
PDB4v67 Crystal structure of a translation termination complex formed with release factor RF2.
ChainDZ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DZ R80 I146 S149 H151 E169 T170 P176 R78 I144 S147 H149 E167 T168 P174
BS02 rna DZ R10 P15 R19 R20 V27 Y29 N30 R31 N34 K36 R72 Q73 E84 H85 D87 F89 R8 P13 R17 R18 V25 Y27 N28 R29 N32 K34 R70 Q71 E82 H83 D85 F87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v67, PDBe:4v67, PDBj:4v67
PDBsum4v67
PubMed19064930
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]