Structure of PDB 4v5c Chain DZ

Receptor sequence
>4v5cDZ (length=176) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPE
3D structure
PDB4v5c Insights Into Substrate Stabilization from Snapshots of the Peptidyl Transferase Center of the Intact 70S Ribosome
ChainDZ
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DZ P176 E178 P174 E176
BS02 rna DZ A113 I146 E169 T170 V175 A111 I144 E167 T168 V173
BS03 rna DZ R10 P15 V27 Y29 N30 R31 R72 Q73 N75 R79 E84 H85 F89 R8 P13 V25 Y27 N28 R29 R70 Q71 N73 R77 E82 H83 F87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5c, PDBe:4v5c, PDBj:4v5c
PDBsum4v5c
PubMed19363482
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]