Structure of PDB 4w29 Chain DY

Receptor sequence
>4w29DY (length=107) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CGGALDT
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainDY
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DY R2 V3 M5 V7 S17 G18 K19 K21 V30 P32 K46 K47 V49 R50 G59 F60 H68 S70 K71 R73 P82 R84 V85 R97 R1 V2 M4 V6 S16 G17 K18 K20 V29 P31 K45 K46 V48 R49 G58 F59 H67 S69 K70 R72 P81 R83 V84 R96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72I15|RL24_THET2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]