Structure of PDB 4v9m Chain DY

Receptor sequence
>4v9mDY (length=107) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CGGALDT
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainDY
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DY R2 K4 M5 V7 K8 S17 G18 K19 V30 Y35 K46 K47 V49 R50 G59 F60 K71 R73 R84 R97 R1 K3 M4 V6 K7 S16 G17 K18 V29 Y34 K45 K46 V48 R49 G58 F59 K70 R72 R83 R96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72I15|RL24_THET2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]