Structure of PDB 4v88 Chain DY

Receptor sequence

>4v88DY (length=126) Species: 559292 (Saccharomyces cerevisiae S288C)

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKLE

3D structure

• PDB: 4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
• Chain: DY
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DY	A2 K3 Q4 S5 S9 S10 R12 A15 R16 Y19 V29 L30 S32 P34 R40 K46 V59 R60 G61 S62 K87 K89 V90 H100 S102 K103 R121 K122	A1 K2 Q3 S4 S8 S9 R11 A14 R15 Y18 V28 L29 S31 P33 R39 K45 V58 R59 G60 S61 K86 K88 V89 H99 S101 K102 R120 K121
BS02	rna	DY	R13 R16 K17 F20 S24 S25 R28 R51 R52 V73 Y74 R75 K113 D114	R12 R15 K16 F19 S23 S24 R27 R50 R51 V72 Y73 R74 K112 D113
BS03	OHX	DY	G44 G123	G43 G122

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v88, PDBe:4v88, PDBj:4v88
• PDBsum: 4v88
• PubMed: 22096102
• UniProt: P05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)