Structure of PDB 6zqg Chain DX

Receptor sequence
>6zqgDX (length=143) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKG
IVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR
3D structure
PDB6zqg 90 S pre-ribosome transformation into the primordial 40 S subunit.
ChainDX
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DX K3 K5 P6 R7 G8 N10 R13 K14 R19 R20 N22 W24 A25 E26 S47 H48 N65 G106 K110 K139 K2 K4 P5 R6 G7 N9 R12 K13 R18 R19 N21 W23 A24 E25 S46 H47 N64 G105 K109 K138
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
GO:0006450 regulation of translational fidelity
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqg, PDBe:6zqg, PDBj:6zqg
PDBsum6zqg
PubMed32943521
UniProtP0CX29|RS23A_YEAST Small ribosomal subunit protein uS12A (Gene Name=RPS23A)

[Back to BioLiP]