Structure of PDB 6zqa Chain DX |
>6zqaDX (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
PFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDG CLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKE KPR |
|
PDB | 6zqa 90 S pre-ribosome transformation into the primordial 40 S subunit. |
Chain | DX |
Resolution | 4.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
DX |
S47 P64 G106 S131 |
S6 P23 G65 S90 |
|
|
|
|