Structure of PDB 4v7y Chain DX

Receptor sequence
>4v7yDX (length=92) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB4v7y Revisiting the structures of several antibiotics bound to the bacterial ribosome.
ChainDX
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DX S14 K16 H31 K36 T37 E38 K40 N41 E44 K53 N55 T56 L57 H58 K62 K63 R65 L66 G67 R68 Y69 L70 K72 R76 K77 K78 S12 K14 H29 K34 T35 E36 K38 N39 E42 K51 N53 T54 L55 H56 K60 K61 R63 L64 G65 R66 Y67 L68 K70 R74 K75 K76
BS02 MG DX T37 V54 T35 V52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7y, PDBe:4v7y, PDBj:4v7y
PDBsum4v7y
PubMed20876130
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]