Structure of PDB 4v83 Chain DW

Receptor sequence
>4v83DW (length=76) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
TKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainDW
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DW T10 N12 R14 S16 A18 K19 R20 V23 K24 Y26 E27 Q29 A33 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 T58 F60 F69 R77 T1 N3 R5 S7 A9 K10 R11 V14 K15 Y17 E18 Q20 A24 I27 R30 R32 G33 T34 R35 G45 R46 D47 F48 T49 F51 F60 R68
BS02 rna DW R72 R74 R63 R65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]