Structure of PDB 4bts Chain DW

Receptor sequence

>4btsDW (length=259) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

ARGPKKHLKRINAPKSWMLNKLGGIWATRPSQGPHKLRESLPLSVLLKER
LNYALNGRDVTLILNDKEQNVFVDGKVRRDKGYPTGLMDVVRIEKTDQSF
RILYDTKGRFVLKSLSKEEAKYKLLKVTAKAIGPNQIPYIVTHDSRTIRF
PNPEIKIGDTLKYDLVNNKIENFAHLESGNVCYIQQGNNIGRVGIIQHIE
KHQGSFDICHVKDAKGNAFATRLGNIFVLGQGKKSWIELPSGDGVRETIL
EERKRKFSY

3D structure

PDB

4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

Chain

Resolution

3.703 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DW	R3 G4 P5 K7 H8 K10 I12 M19 K22 L23 I26 W27 A28 T29 R30 Q33 G34 K37 L38 N57 G58 R59 N66 K68 R79 K108 R110 K131 I133 G134 N136 Q137 S146 R147 T148 R150 N189 H203 Q204 A221 T222 R223 K257	R2 G3 P4 K6 H7 K9 I11 M18 K21 L22 I25 W26 A27 T28 R29 Q32 G33 K36 L37 N56 G57 R58 N65 K67 R78 K107 R109 K130 I132 G133 N135 Q136 S145 R146 T147 R149 N188 H202 Q203 A220 T221 R222 K256

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bts, PDBe:4bts, PDBj:4bts
PDBsum	4bts
PubMed	23851459
UniProt	E6PBS2

[Back to BioLiP]