Structure of PDB 4v88 Chain DV

Receptor sequence
>4v88DV (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
ChainDV
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DV R32 P67 R31 P66
BS02 rna DV G8 T9 K10 F11 R12 S14 G16 P18 A21 Y35 I37 K40 S42 S44 R45 L46 N47 R48 L49 M59 T61 K63 K71 V73 K83 F92 N98 G7 T8 K9 F10 R11 S13 G15 P17 A20 Y34 I36 K39 S41 S43 R44 L45 N46 R47 L48 M58 T60 K62 K70 V72 K82 F91 N97
BS03 MG DV S42 G43 P50 S41 G42 P49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v88, PDBe:4v88, PDBj:4v88
PDBsum4v88
PubMed22096102
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]