Structure of PDB 4v6g Chain DU

Receptor sequence
>4v6gDU (length=102) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CG
3D structure
PDB4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
ChainDU
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DU H6 K8 K9 G18 K19 K21 P32 Y35 I44 K46 K47 V49 V51 G59 F60 H68 S70 K71 R73 R84 V85 H5 K7 K8 G17 K18 K20 P31 Y34 I43 K45 K46 V48 V50 G58 F59 H67 S69 K70 R72 R83 V84
BS02 MG DU M5 H6 M4 H5
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6g, PDBe:4v6g, PDBj:4v6g
PDBsum4v6g
PubMed20400952
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]