Structure of PDB 4v6f Chain DU

Receptor sequence

>4v6fDU (length=102) Species: 300852 (Thermus thermophilus HB8)

RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CG

3D structure

• PDB: 4v6f Structural aspects of messenger RNA reading frame maintenance by the ribosome.
• Chain: DU
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DU	R2 K4 H6 K8 S17 G18 K19 V30 P32 Y35 I44 K46 K47 V49 V51 G59 F60 H68 S70 K71 R73 R84 V85	R1 K3 H5 K7 S16 G17 K18 V29 P31 Y34 I43 K45 K46 V48 V50 G58 F59 H67 S69 K70 R72 R83 V84
BS02	MG	DU	Y55 P56 Q57	Y54 P55 Q56
BS03	MG	DU	K9 E29	K8 E28
BS04	MG	DU	R73 C79 G80	R72 C78 G79
BS05	MG	DU	K4 M5 Y35	K3 M4 Y34
BS06	MG	DU	V45 F60	V44 F59
BS07	MG	DU	C76 A78 C79 G80 K81	C75 A77 C78 G79 K80
BS08	MG	DU	K19 Y20 N43	K18 Y19 N42

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6f, PDBe:4v6f, PDBj:4v6f
• PDBsum: 4v6f
• PubMed: 20400952
• UniProt: Q5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)