Structure of PDB 7aju Chain DT

Receptor sequence
>7ajuDT (length=143) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE
3D structure
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainDT
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DT A11 Q12 Y33 T39 N43 E44 M45 P47 Q48 R57 S60 R63 H64 G72 V73 K75 K78 G87 V88 R89 K92 H93 S99 R102 G120 A10 Q11 Y32 T38 N42 E43 M44 P46 Q47 R56 S59 R62 H63 G71 V72 K74 K77 G86 V87 R88 K91 H92 S98 R101 G119
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtP07280|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)

[Back to BioLiP]