Structure of PDB 4wqy Chain DT

Receptor sequence

>4wqyDT (length=96) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

3D structure

• PDB: 4wqy Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
• Chain: DT
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DT	A12 K14 R15 R17 R22 R23 K27 A28 K29 S31 A32 K34 T35 L36 K38 K39 E51 R57 E60 S61 D64 K65 K68 S70 K74 N75 A78 R79 K81 S82 R83 M85 R89 G101 G102 G103	A5 K7 R8 R10 R15 R16 K20 A21 K22 S24 A25 K27 T28 L29 K31 K32 E44 R50 E53 S54 D57 K58 K61 S63 K67 N68 A71 R72 K74 S75 R76 M78 R82 G94 G95 G96
BS02	MG	DT	A67 G69 L72	A60 G62 L65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wqy, PDBe:4wqy, PDBj:4wqy
• PDBsum: 4wqy
• PubMed: 25594181
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)