Structure of PDB 4v9p Chain DT

Receptor sequence
>4v9pDT (length=85) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB4v9p Control of ribosomal subunit rotation by elongation factor G.
ChainDT
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DT N3 K5 R10 S14 A17 R18 N21 S23 S26 M27 R29 T30 K33 K34 Y36 Q55 P56 D59 R60 K64 N70 K71 A73 R74 K76 N78 T80 Q82 N1 K3 R8 S12 A15 R16 N19 S21 S24 M25 R27 T28 K31 K32 Y34 Q53 P54 D57 R58 K62 N68 K69 A71 R72 K74 N76 T78 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9p, PDBe:4v9p, PDBj:4v9p
PDBsum4v9p
PubMed23812721
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]