Structure of PDB 4v6g Chain DT

Receptor sequence
>4v6gDT (length=92) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
ChainDT
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DT S14 E15 K16 K25 H31 T35 K36 T37 E38 K40 N41 E44 K50 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 Y69 L70 G71 K72 P74 D75 K78 S12 E13 K14 K23 H29 T33 K34 T35 E36 K38 N39 E42 K48 K51 N53 T54 L55 H56 R58 K60 K61 K62 R63 L64 Y67 L68 G69 K70 P72 D73 K76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6g, PDBe:4v6g, PDBj:4v6g
PDBsum4v6g
PubMed20400952
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]