Structure of PDB 4v6a Chain DT

Receptor sequence

>4v6aDT (length=137) Species: 300852 (Thermus thermophilus HB8)

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQK

3D structure

• PDB: 4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
• Chain: DT
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DT	R41 D107 R108 R111 R118	R41 D107 R108 R111 R118
BS02	rna	DT	N2 R3 G4 A5 R23 R51 R53 R54 N55 G56 T60 R95 R96 A97 K98 Y100 F101 K113 K119	N2 R3 G4 A5 R23 R51 R53 R54 N55 G56 T60 R95 R96 A97 K98 Y100 F101 K113 K119

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
• PDBsum: 4v6a
• PubMed: 19696344
• UniProt: P60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)