Structure of PDB 4v63 Chain DT

Receptor sequence
>4v63DT (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQK
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainDT
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DT R39 R41 Q43 D107 R108 R118 K119 D122 R39 R41 Q43 D107 R108 R118 K119 D122
BS02 rna DT N2 G4 A5 R23 R53 R54 N55 N58 T60 R95 R96 A97 K98 K113 K119 N2 G4 A5 R23 R53 R54 N55 N58 T60 R95 R96 A97 K98 K113 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtQ72JU9|RL19_THET2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]