Structure of PDB 4v5e Chain DT

Receptor sequence
>4v5eDT (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQK
3D structure
PDB4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
ChainDT
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DT R41 D107 R108 R111 R115 R118 K119 D122 R41 D107 R108 R111 R115 R118 K119 D122
BS02 rna DT R3 G4 A5 R23 R51 R53 R54 N55 G56 N58 T60 I75 R95 R96 A97 K98 F101 K113 K119 R3 G4 A5 R23 R51 R53 R54 N55 G56 N58 T60 I75 R95 R96 A97 K98 F101 K113 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
PDBsum4v5e
PubMed18988853
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]