Structure of PDB 1vy7 Chain DT

Receptor sequence
>1vy7DT (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA
3D structure
PDB1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
ChainDT
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DT R39 R41 Q43 S106 R108 R111 R118 K119 D122 R39 R41 Q43 S106 R108 R111 R118 K119 D122
BS02 rna DT N2 R3 G4 R23 R51 R53 R54 N55 G56 N58 I75 R95 R96 A97 K98 Y100 F101 K113 R115 K119 N2 R3 G4 R23 R51 R53 R54 N55 G56 N58 I75 R95 R96 A97 K98 Y100 F101 K113 R115 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
PDBsum1vy7
PubMed25132179
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]