Structure of PDB 7aju Chain DS

Receptor sequence
>7ajuDS (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SLVVQEFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDL
HKRAGELTQEELERIVQIMQNPTHYKIPAWFLNHTLANNVESKLRDDLER
LKKIR
3D structure
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainDS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DS K27 Y30 G37 V38 G39 R40 R41 Y42 H55 W84 N87 K23 Y26 G33 V34 G35 R36 R37 Y38 H51 W80 N83
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtP0CX55|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)

[Back to BioLiP]