Structure of PDB 6hiv Chain DS

Receptor sequence

>6hivDS (length=238) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

SRWSSVWPNMRYGSMFLSYSVGRKLPMKGVNWVTRDSNRLLNFSNRYSAV
ISDIDVKRTEEELNVALSDIRWNDHRRIYWKCSFCGSSYRKNVSVRTKYH
AGCNFCKKKYPSEVRGEQHGSPPVSQAAPELTEQLVDNGKRDNLATLAVT
SKFYAEWTCRGCGGSYRSTIRSRTGQVEAGQCTLHPDIVAWSAYCPSCSW
RPNMVPIAEEVSRSGQFLGLERSMEELGPIPRRKRLAC

3D structure

PDB

6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

Chain

Resolution

7.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	DS	S17 R18 W19 S20 S21 W23 N25 R27 G29 S30 M31 F32 L33 Y35 S36 V37 G38 R39 K40 L41 P42 M43 V46 W48 H91 R93 K107 N108 S110 V111 K114 Y115 N120 K123	S1 R2 W3 S4 S5 W7 N9 R11 G13 S14 M15 F16 L17 Y19 S20 V21 G22 R23 K24 L25 P26 M27 V30 W32 H75 R77 K91 N92 S94 V95 K98 Y99 N104 K107
BS02	ZN	DS	C98 C101 C119 C122	C82 C85 C103 C106
BS03	ZN	DS	C175 C178 C211 C214	C159 C162 C195 C198

Gene Ontology

	Cellular Component
GO:0005739	mitochondrion
GO:0005763	mitochondrial small ribosomal subunit

View graph for
Cellular Component

External links

PDB	RCSB:6hiv, PDBe:6hiv, PDBj:6hiv
PDBsum	6hiv
PubMed	30213880
UniProt	Q388L7

[Back to BioLiP]