Structure of PDB 4w29 Chain DS

Receptor sequence
>4w29DS (length=99) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGG
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainDS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DS V14 R15 I18 F87 Y94 E107 G108 G109 V4 R5 I8 F77 Y84 E97 G98 G99
BS02 rna DS R17 F29 S31 L32 H34 Y36 Q38 V46 T47 S50 A55 L56 N61 K62 T63 K93 H95 R7 F19 S21 L22 H24 Y26 Q28 V36 T37 S40 A45 L46 N51 K52 T53 K83 H85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]