Structure of PDB 4v9j Chain DS

Receptor sequence

>4v9jDS (length=99) Species: 262724 (Thermus thermophilus HB27)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGG

3D structure

• PDB: 4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: DS
• Resolution: 3.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DS	R17 R25 S27 F29 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 N61 T63 R89 P91 K93 H95 R97	R7 R15 S17 F19 S21 L22 K23 H24 Y26 Q28 G35 V36 T37 S40 N51 T53 R79 P81 K83 H85 R87
BS02	rna	DS	F12 V14 R15 I18 R20 Q84 Y92 K93 Y94 R106 G108 G109	F2 V4 R5 I8 R10 Q74 Y82 K83 Y84 R96 G98 G99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
• PDBsum: 4v9j
• PubMed: 23812722
• UniProt: Q72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)