Structure of PDB 4v8x Chain DS

Receptor sequence
>4v8xDS (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
ChainDS
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DS R13 R15 I18 R20 F87 Y92 Y94 E107 G108 R3 R5 I8 R10 F77 Y82 Y84 E97 G98
BS02 rna DS R17 R25 S27 F29 S31 L32 K33 H34 Y36 Q38 D42 G45 V46 N61 K62 T63 Y92 K93 H95 G96 R7 R15 S17 F19 S21 L22 K23 H24 Y26 Q28 D32 G35 V36 N51 K52 T53 Y82 K83 H85 G86
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
PDBsum4v8x
PubMed23945936
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]