Structure of PDB 4v5k Chain DR

Receptor sequence

>4v5kDR (length=117) Species: 300852 (Thermus thermophilus HB8)

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

• PDB: 4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
• Chain: DR
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DR	R2 H3 L4 K5 G7 R8 K9 L10 R12 H13 S14 H16 R17 R22 N23 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 H50 H53 R57 L60 H61 R63 R64 R68 R77 R90 G92 G93 R96 K99 R104 R105 G106 D107 V117	R1 H2 L3 K4 G6 R7 K8 L9 R11 H12 S13 H15 R16 R21 N22 K25 S26 H30 I33 T34 T35 T36 P38 K39 K41 H49 H52 R56 L59 H60 R62 R63 R67 R76 R89 G91 G92 R95 K98 R103 R104 G105 D106 V116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5k, PDBe:4v5k, PDBj:4v5k
• PDBsum: 4v5k
• PubMed: 20852642
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)