Structure of PDB 8gxs Chain DQ

Receptor sequence

>8gxsDQ (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]

TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP
LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR
DYIFSKAIGDAEW

3D structure

PDB

8gxs Structures of +1 nucleosome-bound PIC-Mediator complex.

Chain

Resolution

4.16 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	DQ	R344 K346	R81 K83

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091	RNA polymerase II general transcription initiation factor binding
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0017025	TBP-class protein binding
GO:0046982	protein heterodimerization activity
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0060261	positive regulation of transcription initiation by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005669	transcription factor TFIID complex
GO:0005672	transcription factor TFIIA complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0097550	transcription preinitiation complex

External links

PDB	RCSB:8gxs, PDBe:8gxs, PDBj:8gxs
PDBsum	8gxs
PubMed	36201575
UniProt	P52655\|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 (Gene Name=GTF2A1)