Structure of PDB 8c3a Chain DQ

Receptor sequence
>8c3aDQ (length=54) Species: 5476 (Candida albicans) [Search protein sequence]
HENVWFSHPRNFGKGSRQCRHCSSHSGLIRKYGLDLCRQCFREKAADIGF
NKYR
3D structure
PDB8c3a New crystal system to promote screening for new eukaryotic inhibitors
ChainDQ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DQ H3 V6 W7 F8 S9 H10 R12 F14 K16 G17 R19 C24 G29 L30 I31 R32 K33 Y34 R40 Q41 C42 R44 E45 K54 Y55 R56 H1 V4 W5 F6 S7 H8 R10 F12 K14 G15 R17 C22 G27 L28 I29 R30 K31 Y32 R38 Q39 C40 R42 E43 K52 Y53 R54
BS02 MG DQ S26 S28 Q41 S24 S26 Q39
BS03 ZN DQ C24 C42 C22 C40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030445 yeast-form cell wall
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum8c3a
PubMed
UniProtA0A1D8PTR4|RS29A_CANAL Small ribosomal subunit protein uS14 (Gene Name=CAALFM_CR08480CA)

[Back to BioLiP]