Structure of PDB 7aju Chain DQ

Receptor sequence
>7ajuDQ (length=125) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPK
3D structure
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainDQ
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DQ K14 S15 T70 G71 G72 G73 H74 V75 S76 Q77 R122 K12 S13 T68 G69 G70 G71 H72 V73 S74 Q75 R120
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtP0CX51|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)

[Back to BioLiP]