Structure of PDB 4v9j Chain DQ

Receptor sequence

>4v9jDQ (length=141) Species: 262724 (Thermus thermophilus HB27)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: DQ
• Resolution: 3.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DQ	R16 L17 K18	R16 L17 K18
BS02	rna	DQ	L2 P4 R5 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K22 G23 G24 Y26 A28 F29 W41 Q46 A49 R56 K63 R67 F69 T75 K77 E80 V81 R82 M83 G84 K85 K87 G88 R101 R119 I120 H123 K124 K128 Q141	L2 P4 R5 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K22 G23 G24 Y26 A28 F29 W41 Q46 A49 R56 K63 R67 F69 T75 K77 E80 V81 R82 M83 G84 K85 K87 G88 R101 R119 I120 H123 K124 K128 Q141

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
• PDBsum: 4v9j
• PubMed: 23812722
• UniProt: Q72I11|RL16_THET2 Large ribosomal subunit protein uL16 (Gene Name=rplP)