Structure of PDB 4v83 Chain DQ

Receptor sequence

>4v83DQ (length=116) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSRKARETLFAAGNYAYAHRKR
RKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVRE
PQVFAELVERAKAAQG

3D structure

PDB

4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DQ	P2 R3 A4 K5 T6 V8 V9 R10 R11 R12 K13 H14 K15 K16 K19 G23 Y24 W25 G26 L27 R28 S31 R33 K34 R36 E37 A42 Y45 A46 Y47 H49 R50 K51 R52 R53 K54 R55 F57 R58 W61 I62 N66 R70 N75 Y76 S77 H81 K84 R92 K93	P1 R2 A3 K4 T5 V7 V8 R9 R10 R11 K12 H13 K14 K15 K18 G22 Y23 W24 G25 L26 R27 S30 R31 K32 R34 E35 A40 Y43 A44 Y45 H47 R48 K49 R50 R51 K52 R53 F55 R56 W59 I60 N64 R68 N73 Y74 S75 H79 K82 R90 K91
BS02	MG	DQ	S77 T78	S75 T76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum	4v83
PubMed	21245352
UniProt	Q72L76\|RL20_THET2 Large ribosomal subunit protein bL20 (Gene Name=rplT)