Structure of PDB 4v7p Chain DQ

Receptor sequence
>4v7pDQ (length=99) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
3D structure
PDB4v7p Recognition of the amber UAG stop codon by release factor RF1.
ChainDQ
Resolution3.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DQ P2 S12 M15 Q16 K17 T18 R25 L31 Y32 K34 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 R70 R72 R92 N94 Y95 L98 S99 K100 P1 S11 M14 Q15 K16 T17 R24 L30 Y31 K33 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 R69 R71 R91 N93 Y94 L97 S98 K99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum4v7p
PubMed20588254
UniProtP62658|RS17_THET2 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]