Structure of PDB 8gxq Chain DP

Receptor sequence

>8gxqDP (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]

SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK

3D structure

PDB

8gxq Structures of +1 nucleosome-bound PIC-Mediator complex.

Chain

Resolution

5.04 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	DP	V169 F214 S216 K218 V220 Q256 N257 V259 F288 R294 R299 L303 T313	V11 F56 S58 K60 V62 Q98 N99 V101 F130 R136 R141 L145 T155
BS02	dna	DP	Q166 N167 R196 F197 R203 R208 T210 T222 V259 F288 P289 F305 S307 K309 V311	Q8 N9 R38 F39 R45 R50 T52 T64 V101 F130 P131 F147 S149 K151 V153

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0000995	RNA polymerase III general transcription initiation factor activity
GO:0001046	core promoter sequence-specific DNA binding
GO:0001091	RNA polymerase II general transcription initiation factor binding
GO:0001093	TFIIB-class transcription factor binding
GO:0001164	RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0017162	aryl hydrocarbon receptor binding
GO:0019899	enzyme binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297	DNA-binding transcription factor binding

	Biological Process
GO:0001188	RNA polymerase I preinitiation complex assembly
GO:0006352	DNA-templated transcription initiation
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006383	transcription by RNA polymerase III
GO:0007283	spermatogenesis
GO:0042789	mRNA transcription by RNA polymerase II
GO:0045893	positive regulation of DNA-templated transcription
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0060261	positive regulation of transcription initiation by RNA polymerase II

	Cellular Component
GO:0000785	chromatin
GO:0000791	euchromatin
GO:0001673	male germ cell nucleus
GO:0001674	female germ cell nucleus
GO:0001939	female pronucleus
GO:0001940	male pronucleus
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005668	RNA polymerase transcription factor SL1 complex
GO:0005669	transcription factor TFIID complex
GO:0005672	transcription factor TFIIA complex
GO:0005737	cytoplasm
GO:0032991	protein-containing complex
GO:0045120	pronucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gxq, PDBe:8gxq, PDBj:8gxq
PDBsum	8gxq
PubMed	36201575
UniProt	P20226\|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]