Structure of PDB 7enc Chain DP

Receptor sequence
>7encDP (length=177) Species: 9606 (Homo sapiens) [Search protein sequence]
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTT
ALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVG
SCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKV
VLTGAKVRAEIYEAFENIYPILKGFRK
3D structure
PDB7enc Structures of the human Mediator and Mediator-bound preinitiation complex.
ChainDP
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna DP V169 F197 L212 F214 S216 K218 V220 Q256 N257 F288 R294 V301 T313 G314 V9 F37 L52 F54 S56 K58 V60 Q96 N97 F128 R134 V141 T153 G154
BS02 dna DP Q166 N167 R196 F197 R203 T210 F288 P289 F305 S307 K309 Q6 N7 R36 F37 R43 T50 F128 P129 F145 S147 K149
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001046 core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001093 TFIIB-class transcription factor binding
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017162 aryl hydrocarbon receptor binding
GO:0019899 enzyme binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006383 transcription by RNA polymerase III
GO:0007283 spermatogenesis
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045893 positive regulation of DNA-templated transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0000785 chromatin
GO:0000791 euchromatin
GO:0001673 male germ cell nucleus
GO:0001674 female germ cell nucleus
GO:0001939 female pronucleus
GO:0001940 male pronucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005668 RNA polymerase transcription factor SL1 complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0045120 pronucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7enc, PDBe:7enc, PDBj:7enc
PDBsum7enc
PubMed33958484
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]