Structure of PDB 4v8i Chain DP

Receptor sequence

>4v8iDP (length=149) Species: 274 (Thermus thermophilus) [Search protein sequence]

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLE

3D structure

PDB

4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DP	L3 S4 R7 P8 N9 P10 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 P23 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 R50 F51 E52 G53 G54 R55 S56 M60 R61 P63 K64 R65 G66 M67 Q70 V71 P72 G73 E74 I75 R77 N84 R90 G104 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133	L3 S4 R7 P8 N9 P10 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 P23 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 R50 F51 E52 G53 G54 R55 S56 M60 R61 P63 K64 R65 G66 M67 Q70 V71 P72 G73 E74 I75 R77 N84 R90 G104 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
PDBsum	4v8i
PubMed	22605777
UniProt	Q5SHQ7\|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)

[Back to BioLiP]