Structure of PDB 4v7l Chain DP

Receptor sequence

>4v7lDP (length=146) Species: 300852 (Thermus thermophilus HB8)

DLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGG
RSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAG
LLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 4v7l The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
• Chain: DP
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DP	P8 N9 G11 K14 R15 R16 K17 R18 G20 R21 G24 S25 G26 H27 T30 A31 T32 R33 H35 K36 G37 Q38 K39 S40 S42 K46 D47 R50 F51 E52 G53 G54 R55 L59 M60 L62 P63 K64 R65 M67 G69 Q70 V71 P72 G73 E74 I75 R77 N84 R90 G104 L105 K107 K108 K113 G116 E117 S131 K132 S133	P4 N5 G7 K10 R11 R12 K13 R14 G16 R17 G20 S21 G22 H23 T26 A27 T28 R29 H31 K32 G33 Q34 K35 S36 S38 K42 D43 R46 F47 E48 G49 G50 R51 L55 M56 L58 P59 K60 R61 M63 G65 Q66 V67 P68 G69 E70 I71 R73 N80 R86 G100 L101 K103 K104 K109 G112 E113 S127 K128 S129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7l, PDBe:4v7l, PDBj:4v7l
• PDBsum: 4v7l
• PubMed: 20154709
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)