Structure of PDB 4v6g Chain DP

Receptor sequence

>4v6gDP (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
• Chain: DP
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DP	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K18 K22 G23 Y26 Q46 A49 R56 K63 R67 F69 Y74 K76 K77 L79 E80 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K18 K22 G23 Y26 Q46 A49 R56 K63 R67 F69 Y74 K76 K77 L79 E80 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141
BS02	rna	DP	R16 L17 K18 G19	R16 L17 K18 G19
BS03	rna	DP	R56 R60	R56 R60
BS04	MG	DP	L125 I127	L125 I127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6g, PDBe:4v6g, PDBj:4v6g
• PDBsum: 4v6g
• PubMed: 20400952
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)