Structure of PDB 4v5r Chain DP

Receptor sequence

>4v5rDP (length=146) Species: 300852 (Thermus thermophilus HB8)

DLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGG
RSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAG
LLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: DP
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DP	P8 N13 R15 R16 K17 R18 G20 R21 G24 S25 G26 H27 K29 T30 A31 T32 R33 H35 K36 G37 Q38 K39 S40 R41 G43 L45 K46 D47 P48 R49 R50 F51 E52 G53 G54 R55 S56 L59 M60 L62 P63 K64 G66 M67 Q68 Q70 V71 P72 G73 E74 R77 Q81 N84 L105 K108 K113 L115 E117 S131 K132 A134	P4 N9 R11 R12 K13 R14 G16 R17 G20 S21 G22 H23 K25 T26 A27 T28 R29 H31 K32 G33 Q34 K35 S36 R37 G39 L41 K42 D43 P44 R45 R46 F47 E48 G49 G50 R51 S52 L55 M56 L58 P59 K60 G62 M63 Q64 Q66 V67 P68 G69 E70 R73 Q77 N80 L101 K104 K109 L111 E113 S127 K128 A130

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
• PDBsum: 4v5r
• PubMed: 21378964
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)