Structure of PDB 5on6 Chain DO

Receptor sequence
>5on6DO (length=52) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
ChainDO
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DO K93 R97 Y100 R102 T108 N109 R111 K112 R113 K114 G116 H117 N119 R122 K124 K125 K17 R21 Y24 R26 T32 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49
BS02 MG DO R102 R111 R26 R35
BS03 ZN DO C96 C99 C110 C115 C20 C23 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum5on6
PubMed29429877
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]