Structure of PDB 4woi Chain DO

Receptor sequence

>4woiDO (length=88) Species: 544404 (Escherichia coli O157:H7 str. TW14359)

SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR

3D structure

• PDB: 4woi Chemically related 4,5-linked aminoglycoside antibiotics drive subunit rotation in opposite directions.
• Chain: DO
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DO	Q40 R53 V60 R89	Q39 R52 V59 R88
BS02	rna	DO	S2 T5 T8 R17 D21 T22 G23 S24 Q28 L31 Q35 H42 H46 K48 D49 H50 H51 S52 R54 G55 R58 S61 K65 Y69 R72	S1 T4 T7 R16 D20 T21 G22 S23 Q27 L30 Q34 H41 H45 K47 D48 H49 H50 S51 R53 G54 R57 S60 K64 Y68 R71

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Mar 11 10:12:49 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4woi', asym_id = 'DO', title = 'Chemically related 4,5-linked aminoglycoside ant...cs drive subunit rotation in opposite directions.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4woi', asym_id='DO', title='Chemically related 4,5-linked aminoglycoside ant...cs drive subunit rotation in opposite directions.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4woi', asym_id = 'DO'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4woi', asym_id='DO')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>