Structure of PDB 4v9r Chain DO

Receptor sequence
>4v9rDO (length=122) Species: 274 (Thermus thermophilus) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB4v9r The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
ChainDO
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DO P48 R49 R97 P48 R49 R97
BS02 rna DO M1 Q3 Q5 T6 I22 R23 K26 G27 S28 N29 K31 Y32 S42 K44 V57 K66 K67 E68 K70 M1 Q3 Q5 T6 I22 R23 K26 G27 S28 N29 K31 Y32 S42 K44 V57 K66 K67 E68 K70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9r, PDBe:4v9r, PDBj:4v9r
PDBsum4v9r
PubMed24412368
UniProtQ5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]