Structure of PDB 4bts Chain DO

Receptor sequence

>4btsDO (length=152) Species: 5911 (Tetrahymena thermophila)

GRMQMKGKGKGISGSALPFKRRSPKWLHMTPSTVVDLSVKLAKKGLTPSQ
IGVILRDQHGIPQVRFLTGQKILRILKKNGCAPQLPEDLYFLIKKALSIR
KHLEKNRKDKDSKYRLILVESRIHRLSRYYKLNQKLPPKWKYNAQTASAL
VQ

3D structure

• PDB: 4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
• Chain: DO
• Resolution: 3.703 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DO	G2 R3 M4 Q5 M6 K7 G8 K9 K11 I13 S14 G15 S16 A17 L18 P19 R22 P49 S50 G53 R57 P63 R66 K72 L74 R75 E88 D89 F92 L93 K96 H103 K109 D110 K111 K114 Y115 R116 I118 L119 S122 R123 R126 R129 Y130	G1 R2 M3 Q4 M5 K6 G7 K8 K10 I12 S13 G14 S15 A16 L17 P18 R21 P48 S49 G52 R56 P62 R65 K71 L73 R74 E87 D88 F91 L92 K95 H102 K108 D109 K110 K113 Y114 R115 I117 L118 S121 R122 R125 R128 Y129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4bts, PDBe:4bts, PDBj:4bts
• PDBsum: 4bts
• PubMed: 23851459
• UniProt: E6PBT1