Structure of PDB 8cre Chain DN

Receptor sequence

>8creDN (length=98) Species: 5476 (Candida albicans)

PKKRASNGRNKKGRGHVKPVRCLNCARCVPKDKAIKRVTIRNMVEAAAVR
DLSEASVYAEYALPKLYNKLHYCVSCAIHARIVRVRSRTDRKIRTPPQ

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: DN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	P2 K3 K4 R5 A6 S7 N8 G9 R10 N11 K12 K13 G14 R15 G16 H17 K19 R28 K32 K34 K37 R38 K70 V75 S76 I79 H80 R82 R85 V86 R87 S88 R89 R92 R95 P98	P1 K2 K3 R4 A5 S6 N7 G8 R9 N10 K11 K12 G13 R14 G15 H16 K18 R27 K31 K33 K36 R37 K69 V74 S75 I78 H79 R81 R84 V85 R86 S87 R88 R91 R94 P97
BS02	ZN	DN	C23 C77	C22 C76

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A8H6BTS1