Structure of PDB 7lh5 Chain DN

Receptor sequence

>7lh5DN (length=140) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 7lh5 Structural basis for plazomicin antibiotic action and resistance.
• Chain: DN
• Resolution: 3.27 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	K2 T3 Y4 L23 G24 R25 T28 R35 K37 P44 N45 F51 T63 G64 K66 Q69 K70 Y72 R74 Y75 G77 G80 L82 K83 K89 H94 R97 E100 H101 A102 G105 M106 P108 K109 G110 P111 L112 R114 K118 K121 Q131	K2 T3 Y4 L23 G24 R25 T28 R35 K37 P44 N45 F51 T63 G64 K66 Q69 K70 Y72 R74 Y75 G77 G80 L82 K83 K89 H94 R97 E100 H101 A102 G105 M106 P108 K109 G110 P111 L112 R114 K118 K121 Q131
BS02	MG	DN	Q131 A132 Q133	Q131 A132 Q133

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
• PDBsum: 7lh5
• PubMed: 34117352
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)