Structure of PDB 6zqf Chain DN

Receptor sequence
>6zqfDN (length=150) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
3D structure
PDB6zqf 90 S pre-ribosome transformation into the primordial 40 S subunit.
ChainDN
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DN G2 R3 G8 K9 G10 I11 S12 S13 S14 A15 G51 T61 K70 M72 D87 K107 D108 D110 G1 R2 G7 K8 G9 I10 S11 S12 S13 A14 G50 T60 K69 M71 D86 K106 D107 D109
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqf, PDBe:6zqf, PDBj:6zqf
PDBsum6zqf
PubMed32943521
UniProtP05756|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)

[Back to BioLiP]