Structure of PDB 4wqu Chain DN

Receptor sequence
>4wquDN (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB4wqu Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
ChainDN
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna DN A2 R3 K4 A5 L6 E8 K9 R12 F16 K17 V18 R19 Y21 T22 R23 C27 R29 R31 S32 V33 Y34 R35 R41 I42 R45 E46 K58 S60 W61 A1 R2 K3 A4 L5 E7 K8 R11 F15 K16 V17 R18 Y20 T21 R22 C26 R28 R30 S31 V32 Y33 R34 R40 I41 R44 E45 K57 S59 W60
BS02 ZN DN C27 C43 C26 C42
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Mar 12 01:00:44 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4wqu', asym_id = 'DN', title = 'Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4wqu', asym_id='DN', title='Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4wqu', asym_id = 'DN'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4wqu', asym_id='DN')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>