Structure of PDB 4w2i Chain DN

Receptor sequence

>4w2iDN (length=140) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

PDB

4w2i Negamycin Interferes with Decoding and Translocation by Simultaneous Interaction with rRNA and tRNA.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	K2 T3 V5 W13 T22 L23 G24 R25 T28 R35 K37 N45 F51 T63 G64 K65 K66 Q69 K70 Y72 T73 R74 Y75 S76 Y78 P79 G80 L82 K89 R97 H101 A102 G105 M106 P108 K109 P111 L112 R114 K118 H130 Q133	K2 T3 V5 W13 T22 L23 G24 R25 T28 R35 K37 N45 F51 T63 G64 K65 K66 Q69 K70 Y72 T73 R74 Y75 S76 Y78 P79 G80 L82 K89 R97 H101 A102 G105 M106 P108 K109 P111 L112 R114 K118 H130 Q133

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4w2i, PDBe:4w2i, PDBj:4w2i
PDBsum	4w2i
PubMed	25306922
UniProt	P60488\|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)