Structure of PDB 4v83 Chain DN

Receptor sequence

>4v83DN (length=117) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

PDB

4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	R2 H3 L4 K5 S6 G7 K9 L10 N11 R12 S14 S15 H16 R22 N23 Q24 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 G46 D49 H50 H53 H61 R63 R64 R68 R77 R90 Q91 G92 G93 R96 R104 R105 G106 D107	R1 H2 L3 K4 S5 G6 K8 L9 N10 R11 S13 S14 H15 R21 N22 Q23 K25 S26 H30 I33 T34 T35 T36 P38 K39 K41 G45 D48 H49 H52 H60 R62 R63 R67 R76 R89 Q90 G91 G92 R95 R103 R104 G105 D106
BS02	MG	DN	R90 Q91	R89 Q90

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum	4v83
PubMed	21245352
UniProt	Q72I33\|RL17_THET2 Large ribosomal subunit protein bL17 (Gene Name=rplQ)