Structure of PDB 4v7w Chain DN

Receptor sequence

>4v7wDN (length=138) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 4v7w Revisiting the structures of several antibiotics bound to the bacterial ribosome.
• Chain: DN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	Y4 W13 T22 L23 G24 R25 T28 R35 K37 N45 F51 T63 G64 K66 Q69 K70 T73 R74 Y75 S76 Y78 P79 G80 L82 K83 K89 H94 R97 E100 A102 G105 M106 P108 G110 P111 L112 R114 R115 K118 H130	Y4 W13 T22 L23 G24 R25 T28 R35 K37 N45 F51 T63 G64 K66 Q69 K70 T73 R74 Y75 S76 Y78 P79 G80 L82 K83 K89 H94 R97 E100 A102 G105 M106 P108 G110 P111 L112 R114 R115 K118 H130

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7w, PDBe:4v7w, PDBj:4v7w
• PDBsum: 4v7w
• PubMed: 20876130
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)